1.67 Rating by CuteStat

muharikgroup.com is 9 years 9 months old. It is a domain having com extension. It has a global traffic rank of #5157579 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, muharikgroup.com is SAFE to browse.

PageSpeed Score
44
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 93
Daily Pageviews: 186

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 5,157,579
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

65.254.248.130

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 3
H3 Headings: 14 H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 19
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 65.254.248.130)

CharityNet USA - NonProfit & Charity Resource Center

- charitynetusa.com

CharityNet USA is a nonprofit & charity resource center helping non profit organizations, charities and not for profit entities with 501c3, grants, fundraising plus free nonprofit resources.

579,347 $ 1,200.00

Digital Marketing Company with SEO, PPC, Social Media Expertise.

- competeinfotech.com

Award winning Digital Marketing company in Kolkata, India. Get ✔Top Search Engine Ranking, ✔Traffic, ✔Conversion, ✔Brand awareness, ✔Visibility & More! Promote your website with Local SEO, Managed Search Engine Marketing, internet marketing, Online Marketing, Digital Marketing services.

5,827,371 $ 240.00

Energy Trends Insider

- consumerenergyreport.com

Energy news, research, editorials, on all the topics of energy including but not limited to crude oil, gas prices, and alternative energy.

Not Applicable $ 8.95

Site off-line | ProsePoint

- biztechreport.com
Not Applicable $ 8.95

Suraj Nuniyar | Graphic-Web Designer

- surajnuniyar.com

Hello and welcome to my online portfolio. I am Suraj Nuniyar a New York City based graphic/web designer working with clients from all over the world.

2,197,659 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 14 Aug 2014 09:38:47 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 47012
Connection: keep-alive
Keep-Alive: timeout=30
Server: Apache/2
X-Powered-By: PHP/5.3.13
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://www.muharikgroup.com/xmlrpc.php
Link: <http://www.muharikgroup.com/?p=6>; rel=shortlink
Accept-Ranges: bytes
Age: 0

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: Aug 2, 2014, 12:00 AM 9 years 9 months 2 weeks ago
Last Modified: Aug 4, 2014, 12:00 AM 9 years 9 months 1 week ago
Expiration Date: Aug 2, 2015, 12:00 AM 8 years 9 months 1 week ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1.fatcow.com 65.254.254.100 United States of America United States of America
ns2.fatcow.com 65.254.254.101 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
muharikgroup.com A 3599 IP: 65.254.248.130
muharikgroup.com NS 3599 Target: ns2.fatcow.com
muharikgroup.com NS 3599 Target: ns1.fatcow.com
muharikgroup.com SOA 3599 MNAME: ns1.fatcow.com
RNAME: dnsadmin.fatcow.com
Serial: 2014080712
Refresh: 10800
Retry: 3600
Expire: 604800
Minimum TTL: 86400
muharikgroup.com MX 3599 Priority: 30
Target: mx.muharikgroup.com
muharikgroup.com TXT 3599 TXT: v=spf1 ip4:38.113.1.0/24
ip4:38.113.20.0/24 ip4:65.254.224.0/19
?all

Similarly Ranked Websites

Amherst College Store

- amherststore.com
5,157,584 $ 240.00

google

- twitterap.com
5,157,593 $ 240.00

404 Not Found

- watchmostlatestthefile.vip
5,157,596 $ 240.00

404 Not Found

- watchswiftintenselythefile.vip
5,157,597 $ 240.00

Home - Summit Achievement

- summitachievement.com

Summit Achievement, a licensed residential treatment center, is located in the beautiful White Mountain region of Maine. Guided by positive reinforcement and the power of choice, our outcome-focused program employs effective therapeutic and educational principles.

5,157,611 $ 240.00

Full WHOIS Lookup

Domain Name: MUHARIKGROUP.COM
Registrar URL: http://www.godaddy.com
Registrant Name: Adul Chowdhury
Registrant Organization: Muharik Group
Name Server: NS1.FATCOW.COM
Name Server: NS2.FATCOW.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=MUHARIKGROUP.COM

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.